PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01670.1.g00050.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 88aa    MW: 10008.7 Da    PI: 10.8086
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01670.1.g00050.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.32e-282270250
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                  rien++ rqvtfskRr g++KKA+EL +LCdaev +++fs+tg+lye++
  Zpz_sc01670.1.g00050.1.am.mk 22 RIENTTSRQVTFSKRRSGLFKKAKELAILCDAEVGLVVFSNTGHLYEFA 70
                                  8***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.7E-281272IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-231535IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.032173IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-242173IPR002100Transcription factor, MADS-box
PfamPF003194.5E-272269IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-233550IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-235071IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MRLFPQHAVK EQPRKKANPP NRIENTTSRQ VTFSKRRSGL FKKAKELAIL CDAEVGLVVF  60
SNTGHLYEFA NTRFVLLVSS CFLAKLDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445539.19e-27hypothetical protein SORBIDRAFT_07g021110
SwissprotQ6Z6W21e-24MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBLA0A059ASX65e-27A0A059ASX6_EUCGR; Uncharacterized protein
STRINGVIT_00s0211g00150.t013e-26(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.19e-25AGAMOUS-like 21